PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29254.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 302aa    MW: 33434.9 Da    PI: 8.8653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29254.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-174388147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  mrna29254.1-v1.0-hybrid 43 RGHWRPAEDSKLKQLVAQFGPQNWNLIAEHLD-GRSGKSCRLRWFNQ 88
                             899*****************************.***********996 PP

2Myb_DNA-binding56.27.9e-1895138146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r ++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
  mrna29254.1-v1.0-hybrid  95 RRAFSEEEEERLLSAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 138
                              678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5143889IPR017930Myb domain
SMARTSM007178.9E-144291IPR001005SANT/Myb domain
SuperFamilySSF466892.4E-2842136IPR009057Homeodomain-like
PfamPF002492.9E-164388IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-264496IPR009057Homeodomain-like
CDDcd001678.56E-144687No hitNo description
PROSITE profilePS5129426.91390144IPR017930Myb domain
SMARTSM007177.6E-1594142IPR001005SANT/Myb domain
PfamPF002491.1E-1495137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2097143IPR009057Homeodomain-like
CDDcd001671.10E-7106137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGDGVHDRKR KSTMSLNLAG DESDHEDVIQ NPAAAGSTKL CVRGHWRPAE DSKLKQLVAQ  60
FGPQNWNLIA EHLDGRSGKS CRLRWFNQLD PRINRRAFSE EEEERLLSAH RLYGNKWAMI  120
ARLFPGRTDN AVKNHWHVIM ARKHREESNV FKRRKPSSNS LPQHDHDQQD GTKNNASSDR  180
STISINTSND ESGSAASAST CTNLSLTPSN RPALLPSLFS NIKNPFQQQK IFGSQMVADS  240
GRIKGNGNGQ SSDSNSEVSG EESVLTTYRT NNNNVSSMSG EDQIEKMSLI PFIDFLGVGS  300
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-34421436107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301570.20.0PREDICTED: transcription factor MYB44-like isoform X1
TrEMBLM5VQV01e-109M5VQV0_PRUPE; Uncharacterized protein
STRINGPGSC0003DMT4000722582e-90(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-71myb domain protein 105